Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2010 MARIAN NOVOTNÝ.

Podobné prezentace


Prezentace na téma: "DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2010 MARIAN NOVOTNÝ."— Transkript prezentace:

1 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2010 MARIAN NOVOTNÝ

2 PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské univerzitě se specializací strukturní bioinformatika (Gerard Kleywegt) Marie Curie Fellow na Evropském Bioinformatickém Institutu (Janet Thornton & Roman Laskowski) ornitolog amatér

3 OSNOVA co je substrát pro molekulární taxonomii? kde se shromažďují data? jak data vyhledávat ?

4 REKONSTRUKCE EVOLUČNÍ HISTORIE rekonstrukce na základě srovnávání znaků v molekulární taxonomii se používají sekvence sekvence (DNA, RNA, proteiny) se srovnávají tzv. alignmentem

5 KDE NAJÍT SEKVENCE?

6 BIOINFORMATICKÉ DATABÁZE úložiště dat (volně) dostupné pro kohokoliv snadno k nalezení lednové číslo Nucleid Acid Research (NAR)

7 Nucleotide Sequence Databases RNA sequence databases Protein sequence databasesn sequence databases SStructure Databases Genomics Databases (non-vertebrate)mics Databases (non-verteb Metabolic and Signaling Pathwaysng Pathways Human aHuman and other Vertebrate GenomesGenomes Human Genes and Diseases MiMicroarray Data and other Gene Expression Databasesion Databases Proteomics ResourcProteomics Resources Other Molecular Biology Databasesses Organelle databases Plant dataPlant databases Immunological databases LEDNOVÉ ČÍSLO NAR

8 VLASTNOSTI DATABÁZE četnost aktualizace dat četnost aktualizace software redundance anotace dat anotace databáze

9

10

11

12 GenBank(NCBI) -112 Gb ve 112 mil. sekvencí - anotovaných EMBL (EBI) Gb DDJB (Japonsko) DNA DATABÁZE

13 MÁLO ANOTOVANÁ SEKVENCE

14 ANOTOVANÁ SEKVENCE

15

16 GENOMOVÉ DATABÁZE

17

18

19 PROTEINOVÉ DATABÁZE Uniprot - Swissprot + TrEMBL - 10,5 mil. sek. Swiss-prot - anotováno, ~ sekvencí GenPept - překládaný GenBank

20 AMINO ACID COMPOSITION 2.1 COMPOSITION IN PERCENT FOR THE COMPLETE DATABASE ALA (A) 8.57 GLN (Q) 3.88 LEU (L) 9.81 SER (S) 6.72 ARG (R) 5.47 GLU (E) 6.14 LYS (K) 5.30 THR (T) 5.61 ASN (N) 4.17 GLY (G) 7.08 MET (M) 2.45 TRP (W) 1.31 ASP (D) 5.28 HIS (H) 2.20 PHE (F) 4.03 TYR (Y) 3.06 CYS (C) 1.29 ILE (I) 6.00 PRO (P) 4.74 VAL (V) 6.71 ASX (B) GLX (Z) XAA (X) 0.06 UNIPROT + TREMBL

21

22 JAK DATA VYHLEDÁVAT ?

23 >ASTAKINE MKMRGVSVGVLVVAMMSGLAMAGSCNSQEPDCGPSECCLQGWMR YSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY EXISTUJÍ PŘÍBUZNÉ SEKVENCE A KDE JE NAJÍT?

24 HLEDÁNÍ V DATABÁZÍCH - ALGORITMY tradiční algoritmy (Needleman-Wunsch, Smith-Waterman) pomalé pro prohledávání velkých databází používány heuristické metody - rychle vede k výsledku, který se blíží optimálnímu řešení (ale nezaručuje jej) -> pro vyšší rychlost je obětována přesnost (rule of thumb) v případě sekvenčního srovnávání se metoda vzdává jistoty nalezení optimálního alignmentu, aby v krátkém čase provedla srovnání se všemi sekvencemi v databázi ( x rychlejší) klasickými heuristickými metodami jsou FASTA a BLAST obě metody použitelné pro DNA i proteinové sekvence

25 metoda popsaná v 80. letech 20. století (Lipman & Pearson) rychlá, heuristická metoda (na úkor senzitivity), globální alignment zjednodušení v první fázi, sekvence rozděleny na krátké úseky program generuje všechny možné “k-tuples” o délce k z dané sekvence k = 1-2 pro proteiny, k = 4-6 pro DNA k-tuples jsou porovnávány s k-tuples sekvencí v databázích FASTA

26 hledání SHOD v k-tuples skórováni shod pomocí skórovací tabulky (Blosum 50) a rozšíření alignmentu (bez mezer) vysoce skórující shody vybrány vybere úseky, které budou součástí alignmentu dynamické programování pro konečný alignment (mezery)

27 BLAST BLAST = Basic Local Alignment Search Tool Altschul et al., 1990 sekvence rozděleny na slova (words) a slova skórována vůči databázi všech slov slova skórována skórovací tabulkou (Blosum 62) a jen ty, které dosáhnou předem nadefinovaného minimálního skóre (treshold) jsou dále používány slova se skóre větším než treshold nemusí nutně obsahovat jen shody ( na rozdíl od Fasty) v prvním kroku se porovnávají slova bez mezer

28 BLAST - HSP HSP - high scoring pair vyber jen taková “slova”, která dosahují alespoň skóre X (treshold) PEG versus PQA PEQ má s Blosum 62 skóre 15, PQA jen 12 pokud si stanovíme treshold 13, tak budeme dále hledat jen slovo PEQ

29 BLAST II takto vybráná slova jsou hledána v databázi modifikovaným Smith- Watermanem (50 x rychlejší) HSP jsou dále rozšiřovány na obě strany dokud skóre roste v posledním kroku jsou nejlépe skórující páry (HSP`s) podrobeny dynamickému programování, které produkuje výsledné skóre a alignment vzhledem k rostoucí velikosti databází je třeba algoritmus neustále modifikovat (dvě shody v okně definované velikosti) obvykle citlivější než FASTA implementován jako server na řadě míst (NCBI, EBI)

30 VERZE BLASTU blastn - hledá s DNA sekvencí (query) v DNA databázi blastp - hledá s proteinovou sekvencí v proteinové databázi blastx - hledá s DNA sekvencí (6 rámců) v proteinové databázi tblastn - hledá s proteinovou sekvencí v DNA databázi tblastx - překládaná DNA v překládané DNA databázi megablast - víc query najednou

31

32

33 BLAST - VÝBĚR databáze - DNA x protein, anotovaná x kompletní, strukturní, genomové, specializované (protilátky)... organismus datum - sekvence za poslední dva týdny skórovací tabulka - blosum 62 velikost slova low-complexity region filter - často P, D, N, E - false positive “default”nastavení algoritmu vhodné ve většině případů

34 BLOSUM BLOSUM 80 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 80 % BLOSUM 62 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 62 %

35 BLOSUM VERSUS PAM PAM 10 BLOSUM 90 PAM 250 BLOSUM 62 VELMI PŘÍBUZNÍVZDÁLENĚ PŘÍBUZNÍ

36 VÝZNAMNOST NÁLEZU optimální alignment lze nalézt pro jakékoliv dvě sekvence dvě náhodné DNA sekvence = ~ 25% SI dvě náhodné proteinové sekvence = ~ 5% SI jak určit, že je alignment statisticky významný ?

37 PARAMETRY VÝZNAMNOSTI P-value E-value pouze statistická významnost skóre -> biologickou relevanci záhodno ověřovat experimentálně

38 P-VALUE P-value - pravděpodobnost, že sekvence budou srovnány s nalezeným nebo vyšším skóre a zároveň nebudou příbuzné (false positive hit) P-value - pravděpodobnost, že bude skóre x nebo vyššího dosaženo náhodou pro účely výpočtu lze náhodu simulovat přeskládáváním sekvencí nebo výběrem vzorku z databáze druhá možnost lépe odpovídá realitě a poskytuje lepší výsledky (především u DNA)

39 EVD rozložení skóre lokálních alignmentů nepříbuzných sekvencí neodpovídá normálnímu rozdělení, ale rozdělení podle extrémních hodnot (EVD) při normálním rozdělení by docházelo k přeceňování významu dosažených skóre Dundas et al. BMC Bioinformatics 2007

40 P-VALUE P-value (S>x) = 1-exp (-exp (-λ(x-u))), u = charakteristická hodnota = Kmn/λ m,n = délky sekvencí; K = konstanta; λ = “decay factor” K a λ mohou být kalkulovány z vlastností skórovací tabulky

41 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu E-value = x 10 6 =1

42 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí ? Je první “hit” evolučně nejpříbuznější query (hledané sekvenci)? BLAST většinou nalezá příbuzné sekvence nejpříbuznější sekvence však mohou chybět v databázi lokální alignment - často skóruje nejlépe vzdálené příbuzné 7 % sekvencí E.coli mělo nejlépe skórující sekvenci mimo Bacteria

43

44

45 2JTK

46 ROST, 1999 SEQUENCE IDENTITA/HOMOLOGIE NEHOMOLOGNÍ PROTEINY

47 SEQUENCE IDENTITA/HOMOLOGIE ROST, 1999 HOMOLOGNÍ PROTEINY

48 SEQUENCE IDENTITA/HOMOLOGIE sekvenční identita > 35% - pravděpodobně homolog sekvenční identita = 20-35% (“twilight zone”; Doolittle) - může být homolog sekvenční identita < 20% - “midnight zone” (Rost) - sekvence zcela nedostatečná k určení homologie

49 Average sequence identity of random alignments % Average sequence identity of remote homologues % Sander et al., preprint

50 SSEARCH pokud máte moře času nebo počítačový klastr nebo jste zoufalí rigorózní Smith-Waterman - local alignment v databázi

51 DALŠÍ METODY HLEDÁNÍ V DATABÁZÍCH profilové metody HMM modely

52 PROFILY modifikují skórovací tabulky specificky pro skupiny proteinů a pozici v alignmentu (např. globiny) pro každou pozici v alignmentu jsou generovány specifická skóre jak pro záměnu za jakoukoliv aa, tak pro inzerci nebo deleci Prof (pos,aa) = Σ type N(pos,type) x S(type, aa) x 10 N(pos,type) = podíl výskytu aa x na pozici y S(type, aa) = skóre skórovací tabulky pro zaměňovaný pár

53 PŘÍKLAD PROFILU v alignmentu globinů se na pozici 3 vyskytuje 3x Ala, 6x Val, 1x Ile, používáme tabulku Blosum 62 jaké bude profilové skóre pro výskyt Ile a His ? N(x,A) = 0.3, N(x,V) = 0.6, N(x, I) = 0.1 S(A,I) = -1, S(V,I) = 3, S(I,I) = 4 S(A,H) = -2, S(V,H) = -3, S(I,H) = -3 Prof (x, I) = 0.3 x x x 4 = 2.1 x 10 (v profilu) = 21 ( -1, 3, 4) Prof (x, H) = 0.3 x x x -3 = -2.7 x 10 = -27 (-2, -3, -3)

54 PSI-BLAST PSI-BLAST = Position Specific Iterative Blast Altschul et al., 1997 profilová metoda, používá Position Specific Scoring Matrix (PSSM) v prvním kole klasický BLAST, z vysoko skórujících alignmentů je generována PSSM v dalším kole hledání je už použita nová matrice a následně znovu generována nová PSSM opakováno libovolně dlouho (až ke konvergenci) benchmark metoda

55 HMM HMM = Hidden Markov Model profilová metoda, používána při rozhodování, zda protein spadá do jisté skupiny proteinů, typicky pro sekvence s nízkou %SI velmi citlivá metoda, která vytváří statistický model pro definovanou skupinu sekvencí na základě “tréninku” na sekvencích patřících do jedné skupiny (globiny) generuje pravděpodobnost nejen pro jednotlivé záměny a inzerce a delece, ale i pro přechody mezi nima dovede do modelu zahrnout i aminokyseliny, které se v tréninkové skupině nevyskytují alignment s největší pravděpodobností je optimální posuzuje jak dobře daná sekvence odpovídá modelu

56 HMM

57 SHRNUTÍ databáze by měly být pravidelně updatovány přehled dostupných biologických databází vždy v lednovém čísle NAR řada velmi specializovaných databází hledání v databázích povětšinou heuristickými metodami standard dnes BLAST nutno hodnotit statistickou významnost nálezu citlivější metodou PSI-Blast nebo HMM metody

58

59

60

61

62

63

64

65

66

67

68

69

70

71

72

73

74

75

76

77

78

79

80

81

82

83

84

85

86

87

88

89

90

91

92

93

94


Stáhnout ppt "DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2010 MARIAN NOVOTNÝ."

Podobné prezentace


Reklamy Google