Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

Nástroje pro zpracování a grafickou úpravu sekvenčních dat Jaro 2015.

Podobné prezentace


Prezentace na téma: "Nástroje pro zpracování a grafickou úpravu sekvenčních dat Jaro 2015."— Transkript prezentace:

1 Nástroje pro zpracování a grafickou úpravu sekvenčních dat Jaro 2015

2 ColorSeq Vyznačte v sekvenci všechny tryptofany, tyrosiny a cysteiny.

3 Protein Colourer LENKAPEPAMARTINWALTERGITAADAMAGATAAGNESALANC ECILCEDRIKDALIDADANAEMILIEERIKEVAFILIPGERHAR DHERMINAKARELKATERINAMARLENAMARKETAVALDEMARA VLASTIMILA Obarvěte si sekvenci...

4 Filter Protein/DNA

5 Three to One

6 One to Three

7 Three- / one-letter code

8 GGGGACCGCCGCACCGUUAUCAGCCGUCA UAUCGACUACCGGAGGGCGAGACAGACGA UCGGUGUUAGCUACUUACAUGGCGUUCGA GAGUUGCUACGCGGUAGGCUUGACUCCAA CUACAACGGAACGUGAAUCUCAUUUUGGG UUUUAGAUAUUGGGGUCGAAUCCAGCGAA AGCAUUAUUAAGGGGCUCCGUAACCUGGA UGGAACAUUGAGGUCUUUCAGUUCAACGA AUCCUGGAUAGGGCGCAACUCCCACUACA CCAACUUUAACCUCACAUUACCCUGUUCU UAUUGCGCAA Reverse Transcription and Translation Tool Pohrajte si s RNA...

9 Reverse Translate LENKAPEPAMARTINWALTERGITAADAMAGATAAGNESALANCECILCEDRIK DALIDADANAEMILIEERIKEVAFILIPGERHARDHERMINAKARELKATERIN AMARLENAMARKETAVALDEMARAVLASTIMILA Přeložte si protein...

10 LENKAPEPAMARTINWALTERGITAADAMAGATAAGNESALANCECILCEDRIK DALIDADANAEMILIEERIKEVAFILIPGERHARDHERMINAKARELKATERIN AMARLENAMARKETAVALDEMARAVLASTIMILA Reverse Translate Přeložte si protein...

11 PepDraw Kolik aminokyselin program zvládne?

12 TOPO2

13 MyDomains

14 PLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAI ATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYAS LSAIWGTAAPSSQGSGNQGAETGGTGAGNIGGGGERDGTFNLPPHIKFGVTALTHAANDQT IDIYIDDDPKPAATFKGAGAQDQNLGTKVLDSGNGRVRVIVMANGRPSRLGSRQVDIFKKS YFGIIGSEDGADDDYNDGIVFLNWPLG 271 aa, TNF like domain, Lectin domain, vazebné místo, vazebné místo

15

16 Vytvořte „doménové schéma“ proteinu.


Stáhnout ppt "Nástroje pro zpracování a grafickou úpravu sekvenčních dat Jaro 2015."

Podobné prezentace


Reklamy Google