Vývoj vizualizačního nástroje pro metadynamické simulace Metadyn view Petr Hošek, Vojtěch Spiwok Ústav biochemie a mikrobiologie, Vysoká škola chemicko-technologická v Praze, Technická 3, Praha 6, 166 28, Česká republika, e-mail: hosekp@vscht.cz 11.11.2014 Seminář ústavu biochemie a mikrobiologie

Sbalování proteinu Problém s překonáváním energetických bariér >tr|Q56G89|Q56G89_HUMAN Serum albumin OS=Homo sapiens PE=2 SV=1 MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQGLKCASLQKFGERAFKAWAV…. Náhodné skládání – moc moc dlouho (Levinthalův paradox) Skládání v buňce – ~10 ms (pro 100AMK protein) Skládání v počítači – 7,5 let na PC (10ms, 100amk, implicitní solvent) Problém s překonáváním energetických bariér

Metadynamika Metoda s vylepšeným vzorkováním Přidává umělý potenciál Snadnější překonávání energetických bariér Přidává umělý potenciál => zmapování plochy volné energie (v prostoru kolektivních souřadnic) But, sometimes conformation changes are too slow for simulations :-) That‘s why enhanced sampling methods have been developed, especially Metadynamics. Metadynamics simulation visits other local minima in shorter time, because it disfavor already visited states by applying the potential. You can see here, that after several steps, system moved into this local minimum, because this one is full of bias potential. And later on, this minumum have been visited too. After the end of the simulation, we got this energy profile, or ,as we call it, energy landscape.

Metadynamika K čemu potřebujeme plochu volné energie? Pravděpodobnosti stavů Reakční koordináta Termodynamika + Kinetika reakce But why we need energy landscapes? Because they can tell us a lot of about the simulated systems, mainly termodynamic and kinetic attributes. We can estimate, how many molecules will rest in this local minimum, or this one, because we know the energy difference between them. We can estimate, how fast the molecules will move from the this minumum to the second minumum, because we know energy of the saddle point between them. This can be valuable for real applications, such as ….

Vizualizace Metadynamiky Suma 2D gaussianů 𝐸=ℎ 𝑒 − 𝑥− 𝑥 0 2 2 𝜎 𝑥 2 − (𝑦− 𝑦 0 ) 2 2 𝜎 𝑦 2 100000 x 200 x 200 = 4 miliardy operací But with use of advanced technologies (HTML5 canvas, computations on grafic card and faster typed arrays), I was able to create viewer powerful enough to display metadynamics in progress. And you only need modern internet browser. And now, I will show you the viewer in action Moc náročné!

Vizualizace Metadynamiky Suma 2D gaussianů 𝐸=ℎ 𝑒 − 𝑥− 𝑥 0 2 2 𝜎 𝑥 2 − (𝑦− 𝑦 0 ) 2 2 𝜎 𝑦 2 100000 x 200 x 200 = 4 miliardy operací Spočítání gaussianu pouze jednou Sčítání polí => mnohem rychlejší 1 2 3 5 7 But with use of advanced technologies (HTML5 canvas, computations on grafic card and faster typed arrays), I was able to create viewer powerful enough to display metadynamics in progress. And you only need modern internet browser. And now, I will show you the viewer in action

Metadyn view Webový nástroj Javascript HTML5 WebGL – výpočty na grafické kartě Typované pole rychlejší než běžné JS pole But with use of advanced technologies (HTML5 canvas, computations on grafic card and faster typed arrays), I was able to create viewer powerful enough to display metadynamics in progress. And you only need modern internet browser. And now, I will show you the viewer in action

Metadyn view Kompatibilita: Manuskript ve výrobě WebGL kompatibilita není podmínkou Manuskript ve výrobě But with use of advanced technologies (HTML5 canvas, computations on grafic card and faster typed arrays), I was able to create viewer powerful enough to display metadynamics in progress. And you only need modern internet browser. And now, I will show you the viewer in action

Poděkování Díky za pozornost Můj školitel – Vojtěch Spiwok I would like to thank my supervisor, Vojtěch Spiwok, for guidance and my group for psychical support. Unfortunately, I haven‘t any photo of them to show you. Thank you for your attention. If you have any questions or suggestions to my project, feel free to speak.