Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

Proteinové databáze.  Základní stavební jednotky proteinů  Hierarchie proteinové struktury  Stanovení proteinové struktury  Důležitost proteinové.

Podobné prezentace


Prezentace na téma: "Proteinové databáze.  Základní stavební jednotky proteinů  Hierarchie proteinové struktury  Stanovení proteinové struktury  Důležitost proteinové."— Transkript prezentace:

1 Proteinové databáze

2  Základní stavební jednotky proteinů  Hierarchie proteinové struktury  Stanovení proteinové struktury  Důležitost proteinové struktury  Proteinové strukturní databáze  Proteinové klasifikační databáze  Strukturní soubory  Vizualizace proteinových struktur Osnova 2/33 Strukturní databáze

3 Základní stavební jednotky 3/33 Strukturní databáze

4  Primární struktura  Sekundární struktura  Terciární struktura  Kvartérní struktura Hierarchie proteinové struktury 4/33 Strukturní databáze

5  Primární struktura  Lineární sekvence aminokyselinových zbytků MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLG RLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGS ALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQD NVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIA RDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPD EIGAAIAAFVRRLRPA Hierarchie proteinové struktury 5/33 Strukturní databáze

6  Sekundární struktura  Lokální prostorové uspořádání peptidového řetězce Hierarchie proteinové struktury 6/33 Strukturní databáze

7  -helix  Sekundární struktura  Lokální prostorové uspořádání peptidového řetězce Hierarchie proteinové struktury 7/33 Strukturní databáze

8  -řetězec  Sekundární struktura  Lokální prostorové uspořádání peptidového řetězce Hierarchie proteinové struktury 8/33 Strukturní databáze

9  Terciární struktura  Globální prostorové uspořádání polypeptidového řetězce Hierarchie proteinové struktury 9/33 Strukturní databáze

10  Kvartérní struktura  Aglomerát několika polypeptidových řetězců Hierarchie proteinové struktury 10/33 Strukturní databáze

11 Určení proteinové struktury European Synchrotron Radiation Facility, Grenoble, France 11/33 Strukturní databáze

12 Určení proteinové struktury 600 MHz Ultrashield NMR Spetrometer 12/33 Strukturní databáze

13 Určení proteinové struktury FEI Tecnai T12 Cryotransmission Electron Microscope 13/33 Strukturní databáze

14  Proteinová krystalografie  Atomární rozlišení  Bez omezení velikosti molekul (virových částic)  Nutnost přípravy proteinových krystalů Určení proteinové struktury 14/33 Strukturní databáze

15  Proteinová krystalografie  Atomární rozlišení  Bez omezení velikosti molekul (virových částic)  Nutnost přípravy proteinových krystalů Určení proteinové struktury  Nukleární magnetická rezonance  Atomární rozlišení  Omezení velikostí molekul (40 kDa)  Vzorek proteinu v roztoku = dynamika 15/33 Strukturní databáze

16  Proteinová krystalografie  Atomární rozlišení  Bez omezení velikosti molekul (virových částic)  Nutnost přípravy proteinových krystalů Určení proteinové struktury  Nukleární magnetická rezonance  Atomární rozlišení  Omezení velikostí molekul (40 kDa)  Vzorek proteinu v roztoku = dynamika  Kryoelektronová mikroskopie  Subatomární rozlišení 16/33 Strukturní databáze

17 MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCA GLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVV HDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRS QAGEELVLQD funkce Důležitost proteinové struktury 17/33 Strukturní databáze

18 Důležitost proteinové struktury 18/33 Strukturní databáze

19  RCSB PDB – Protein Data Bank  Světový depositář struktur biomakromolekul Proteinové strukturní databáze 19/33 Strukturní databáze

20  RCSB PDB – Protein Data Bank  Research Collaboratory for Structural Bioinformatics (RCSB)  Služba pro odesílání struktur, prohlížení a vyhledávání dat  Sumární informace a struktura  Jedinečný identifikační kód PDB-ID (1EDE)  Interaktivní vizualizace  Hledání strukturních sousedů  Reference a hyperlinky do dalších databází Proteinové strukturní databáze 20/33 Strukturní databáze

21  PDBsum  Přehled a analýza proteinových struktur Proteinové strukturní databáze 21/33 Strukturní databáze

22  PDBsum  Souhrnné informace  Sekundární struktury  Katalytické a vázající aminokyselinové zbytky  Ligandy  Dutiny  Protein-proteinové interakce  Konzervovanost aminokyselinových zbytků  Reference a hyperlinky do dalších databází Proteinové strukturní databáze 22/33 Strukturní databáze

23 všechny alfavšechny betaalfa+beta alfa/beta  Identifikace a kvantifikace strukturních podobností  Strukturní podobnost souvisí s evolucí a implikuje funkci Proteinové klasifikační databáze 23/33 Strukturní databáze

24  SCOP – Structural Classification of Proteins  Založena na manuálním srovnání struktur expertem (A. Murzin) Proteinové klasifikační databáze 24/33 Strukturní databáze

25  CATH – Class, Architecture, Topology, Homology  Založena na kombinaci automatického strukturního přiložení programem SSAP a manuálního srovnání, E.C. kódování Proteinové klasifikační databáze 25/33 Strukturní databáze

26  classification scheme may be different in different databases Proteinové klasifikační databáze 26/33 Strukturní databáze

27  PDB formát  Široce používaný  Snadno čitelný  Identifikátory struktury  Literární reference  Experimentální podmínky  XYZ koordináty struktury Strukturní soubory 27/33 Strukturní databáze

28  PDB formát Strukturní soubory 28/33 Strukturní databáze

29  mmCIF formát  Snadno analyzovatelný počítačovými programy Strukturní soubory 29/33 Strukturní databáze

30 all atoms backbone with secondary structure surface Vizualizace proteinových struktur 30/33 Strukturní databáze

31  PyMOL  RasMol  Swiss-PdbViewer  Chimera  Jmol  Cn3D  WebMol  VMD  Proteopedia Vizualizace proteinových struktur 31/33 Strukturní databáze

32 Vizualizace proteinových struktur 32/33 Strukturní databáze

33  Claverie, J-M., & Notredame, C. (2006). Bioinformatics For Dummies (2nd ed.). Wiley Publishing, Hoboken, p  Xiong, J. (2006). Essential Bioinformatics. Cambridge University Press, New York, p  BioVisions na Harvardově univerzitě:  RCSB PDB:  PDBsum:  SCOP:  CATH:  PyMOL:  ProteoPedia: Reference 33/33 Strukturní databáze


Stáhnout ppt "Proteinové databáze.  Základní stavební jednotky proteinů  Hierarchie proteinové struktury  Stanovení proteinové struktury  Důležitost proteinové."

Podobné prezentace


Reklamy Google