Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

Neuropřenašeče: neuropeptidy a puriny

Podobné prezentace


Prezentace na téma: "Neuropřenašeče: neuropeptidy a puriny"— Transkript prezentace:

1 Neuropřenašeče: neuropeptidy a puriny
Neurochemie: Neuropřenašeče: neuropeptidy a puriny 6. přednáška

2 Purinergní neuropřenašeče, zejména adenosin a ATP, nebyly v rámci přenosu nervového impulsu dlouho vůbec uvažovány. úloha neuropeptidů v CNS spíše modulační fungují jako neuropřenašeče, ale mnoho jejich dalších funkcí zatím neobjasněno především látky centrálně zapojené do intermediátního metabolismu přesto koncentrovány na určitých typech synapsí a po patřičném stimulu se z nich uvolňují, aby vyvolaly patřičnou odpověď NEUROPEPTIDY malé molekuly složené z aminokyselin navzájem kovalentně propojených peptidickou vazbou neuropeptidy je rezervován pro malé proteiny, které mají neurotransmiterům podobnou funkci v rámci nervového systému (De Vied 1969) neuropeptidy = malé proteiny, které mají neurotransmiterům podobnou funkci v rámci nervového systému (CNS i PNS) nejen neuropřenašeče: některé jsou neurony uvolňovány přímo do krevního řečiště a slouží jako hormony jiné jako hormony uvolňovány endokrinními žlázami popsána zatím více než stovka

3 Progress in Brain Research, Vol. 72, Chapter 9, David de Wied

4 Klasifikace neuropeptidů
tradičně se dělí do skupin podle oblastí, ve kterých byla jejich funkce poprvé popsaná, nebo podle svého účinku  nepřesné: ACTH a a-MSH se nachází nejen v neurohypofýze, ale i non neuroendokrinních neuronech a mají i non-neuroendokrinní funkce  mohou koexistovat s „klasickými“ neuropřenašeči

5 Přehled genových rodin neuropeptidů na
více než 10 neuropeptidových tříd dle strukturních podobností a arbitrární funkce více než 70 kódujících genů Přehled genových rodin neuropeptidů na gen a jeho symbol lokalizace na chromosomu prekurzor aktivní peptid/y exprese v mozku myši

6 Rodiny neuropeptidů u různých živočišných kmenů

7 Kredit: Front Endocrinol (Lausanne). 2013 Aug 6;4:96
 syntéza neuropeptidu vyžaduje transkripci DNA, její přepis do mRNA a tvorbu proteinu Prekurzorové proteiny  proteinový produkt uvolněný z ribosomu = velký prekurzorový polypeptid vyžadující posttranslační úpravy (prepropeptid) Kredit: Front Endocrinol (Lausanne) Aug 6;4:96

8 Vznik a zpracování prepropeptidu proopiomelanokortinu (POMC)
Prekurzorové proteiny  syntéza neuropeptidu vyžaduje transkripci DNA, její přepis do mRNA a tvorbu proteinu  proteinový produkt uvolněný z ribosomu = velký prekurzorový polypeptid vyžadující posttranslační úpravy (prepropeptid) Vznik a zpracování prepropeptidu proopiomelanokortinu (POMC)  POMC = prekurzor mnoha aktivních peptidů  jeho produkty zahrnují např. adrenokortikotropní hormon (ACTH), a-melanocyty-stimulující hormon nebo b-endorfin  prepropeptid obsahuje N-koncovou signální sekvenci (nasměruje nově vzniklý protein z ribosomů do lumen ER)  po transportu do ER signální sekvence odštěpena signální peptidasou  vzniká propeptid  propeptid je přenesen do Golgiho aparátu  uskladněn do velkých denzních váčků  v těch dále zpracováván  ve váčcích z těla buňky transportován na synapsi

9 Proteolytické zpracování
 propeptidové prekurzory konvertovány na aktivní neuropeptidy sérií kroků  zahrnuje štěpení konvertasami a modifikaci na specifických aminokyselinových zbytcích  endoproteasy rozpoznávají a štěpí dibasické aminokyselinové páry (Lys-Arg, Lys-Lys, Arg-Arg nebo Arg-Lys)  vzniklé peptidy jsou dále zpracovány exopeptidasami a různými modifikujícími enzymy  fenomén zpracování prohormonů konvertasami popsán Donaldem F. Steinerem během studia vzniku insulinu (1967)  dva klíčové enzymy: konvertasa prohormonů 1 a 2 (PC1 a PC2)  náleží do velké rodiny prohormonových konvertas zahrnující (zatím) 9 členů  označovány též PCSK1-9, přičemž PSK1 = PC1 (PC3) a PCSK2 = PC2  postupují krokově, nejprve rozštěpí v závislosti na typu tkáně patřičný dibasický pár  následně pokračují v dalších štěpeních  PC1 a PC2 štěpí různými způsoby POMC  stejnou proteolytickou aktivitu vykazují na proinsulinu a proglukagonu v pankreatu  PC2 hraje větší roli než PC1 v případě proinsulinu než proglukagonu  PC1 je naopak pro štěpení glukagonu důležitější a méně využívaná pro štěpení proinsulinu než PC2  výsledek proteolytické aktivity PC1 i PC2 na POMC = malé peptidy, jejichž C nebo N konce obsahují lysinové nebo argininové zbytky PC1

10 Proteolytické zpracování
 karboxypeptidasa E pak odstraňuje C-koncové zbytky  zatím neidentifikovaná aminopeptidasa odstraňuje zbytky N-koncové.  další úpravy po konvertasach a peptidasach: N-koncová acetylace, které často reguluje aktivitu neuropeptidu (zesílení biologické aktivity a-MSH nebo její pokles v případě b-endorfinu)  peptidy obsahující C-terminální glycin: a-amidací pomocí enzymu peptidglycin a-amidující monooxygenasy (PAM); tento amidační krok podstupuje např. a-MSH  konvertasy prohormonů antagonisticky ovlivňují mnohé malé peptidy  inhibitory angiotensin konvertujícího enzymu (ACE): captopril  klinicky využíván v léčbě hypertenze (angiotenzin fyziologicky zvyšuje cévní tonus) nebo diabetické nefropatie Diversita neuropeptidů jediný propeptid = několik bioaktivním neuropeptidům  jednotlivé kroky proteolytického štěpení tkáňově specifické  v předním laloku podvěsku mozkového POMC typicky konvertován na ACTH  v intermediátním laloku a v neuronech produkujících POMC hlavními koncovými produkty a-MSH a b-endorfin  tkáňově specifická exprese různých konvertas prohormonů  konvertasy jsou vysoce citlivé na pH a Ca2+, jejich aktivita závisí i na změnách těchto parametrů uvnitř váčků

11 Diversita neuropeptidů
alternativní sestřih  prvně zjištěn u kalcitoninu a kalcitoninovému genu příbuzného peptidu (calcitonin gene-related peptide, CGRP)  tachykininy = produkce několika zástupců své rodiny alternativním sestřihem dvou preprotachykininových genů  jeden z genů je alternativně sestřižen nejméně ve tři prepropeptidy, které dále posttranslačně produkuji pět rozdílných bioaktivních peptidů včetně neurokininu A a substance P Skladování a výlev  oproti např. acetylcholinu vznikají transkripcí, translací a dále jsou upravovány posttranslačně  tyto procesy probíhají v somatu i axonu  neuropeptidy obsaženy ve velkých denzních vesikulech skládaných v Golgiho komplexu a transportovaných na synapsi  mnoho neuronů obsahuje v synaptickém zakončení OBA typy váčků  neuropeptidy poměrně typicky kolokalizovány s „klasickými“ neuropřenašeči  oba typy váčků uvolňovány odlišným mechanismem a často za jiných fyziologických podmínek a potřeb  k výlevu neuropeptidů je potřeba delšího a většího zvýšení hladiny Ca2+  typický vzorec vzruchové aktivity může tedy vést k preferenčnímu výlevu jednoho nebo druhého typu neurotransmiteru, případně za sebou mohou následovat  neuropeptidy modulují postsynaptický účinek klasických neuropřenašečů, a to buď stimulačně nebo inhibičně silně stimulovaných zakončení

12 Neuropeptidy vs. nízkomolekulární neuropřenašeče
Vzhledem k tomu, že k výlevu neuropeptidů je potřeba delší vzruchová aktivita, mohou pozitivní i negativní zpětnou vazbou regulovat aktivitu silně stimulovaných zakončení.

13 Neuropeptidová signalizace „na dálku“
 oproti klasickým neuropřenašečům nejsou rychle odstraňovány ze synaptické štěrbiny  deaktivace probíhá štěpením endoproteasami a exoproteasami lokalizovanými na extracelulárních membránách (nezaměňovat s konvertasami!)  mohou urazit značnou vzdálenost, než doputují ke svým receptorům (lokalizace mnoha neuropeptidů neodpovídá lokalizaci jejich receptorů)  substance P vysoce koncentrována v substantia nigra, ale její receptory v této struktuře téměř chybí, zatímco v jiných částech mozku jsou detekovány hojně  většina receptorů pro neuropeptidy spřažena s G-proteiny  mají pro své ligandy podstatně větší afinitu než receptory pro neuropřenašeče „klasické“ (ACh R afinita 100 mM – 1 mM, neuropeptidové Rs v řádu nanomolů)  interakce mezi neuropeptidy a jejich receptory je poměrně komplexní  molekula noradrenalinu = jen těch několik atomů iontově nebo stericky interaguje s patřičným vazebným místem na odpovídajících receptoru, vs.  interakce neuropeptidu Y (NPY) o délce 36 aminokyselin: jak se takové molekula vůbec „vejde“ do vazebného místa receptoru spřaženého s G-proteinem? Která konformace bude mít nejvyšší afinitu pro vazbu? Který aminokyselinový zbytek je pro vazbu kritický? A z kterého farmakologického pohledu mohou být připravovány nové látky, které budou dané vazebné místo antagonizovat nebo na něj budou působit agonisticky?  v praxi zatím v rovině modifikovaných peptidových analogů  syntetické peptidy jsou degradovány různými peptidasami, neprochází skrze hematoencefalickou bariéru, užitečné v podpůrné léčbě poruch zasahujících CNS

14 Vazebné modely receptoru pro NPY
Kredit: Front. Endocrinol., 04 February 2013 | doi: /fendo

15 Receptorové typy a subtypy
 neuropeptidové receptory příliš početné  rozděleny do jednotlivých rodin  některé neuropeptidy (TRH) se sice váží jen na jediný receptor, ale mnoho jiných (např. somatostatin) obsazuje až pět receptorových typů  v rámci každé receptorové rodiny vykazují jednotlivé subtypy receptorů své vlastní vzorce exprese v CNS i PNS  CRF1R a CRF2R = dva receptory pro kortikotropin-uvolňující faktor (corticotropin- releasin factor, CRF)  svou expresí alterují: tam, kde se vyskytuje jeden, není téměř detekovatelný ten druhý  liší se afinitou k ligandům (CRF1R stejně silně váže CRF i příbuzný peptid urocortin, zatímco CRF2R má vyšší afinitu k urocortinu než CRF)  tato rozdílná distribuce má fyziologický význam  i další neuropeptidergní receptory mohou vázat víc než jeden peptid  receptory melanokortinové rodiny = MC1-5 receptory  každý z těchto receptorů může s různou potencí aktivovat ACTH, a-MCH a g-MCH  MC4 receptor může být antagonizován také vzdáleně příbuzných endogenním peptidem nazvaným agouti-related peptid  MC4 receptor = první receptor, u kterého byl v mozku nalezen endogenní agonista i antagonista.

16 Rodiny GPCR Rs třídy A u různých živočišných kmenů
Třída-A GPCR Rs: Rs pro tachykinin, neuromedin-U/pyrokinin, vasopressin/oxytocin, GnRH/corazonin/AKH, allatostatin-C/somatostatin a cholecystokinin/sulfakinin Kredit oboje: Gáspár Jékely PNAS 2013;110:

17 Receptorové typy a subtypy

18 Specifita receptoru pro ten který peptid je dána výhradně vnitřními vlastnostmi receptoru?
 mnohé domény na extracelulárních i transmembránových doménách byly známy jako specifická vazebná místa pro určité ligandy:   proteiny modifikujících aktivitu receptoru (receptor activity modifying proteins, RAMPs):   ovlivňují transport CGRP receptoru do membrány a jeho glykosylaci  podmiňují afinitu CGRP receptoru k příbuznému proteinu adrenomedullinu  asi regulují funkce VIP, sekretinového a glukagonového receptoru (GPCRs skupiny B)  peptidergní receptory nejen na synapsi  v menší míře i na plasmatické membráně axonů, těl neuronů i dendritů  u některých subtypů je možná jejich extrasynaptická lokalizace primární  po delší vazbě ligandu na tyto receptory spřažené s G-proteiny receptory internalizovány  následně buď recyklovány, nebo degradovány  výjimky: receptor pro neurotensin je i s navázaným ligandem transportován do těla neuronu a byl prokázán poblíž jádra  nepotvrzeno, ale peptidergní receptory by mohly hrát i roli v kontrole genové transkripce RAMP1 (isoformy RAMp1-3)

19 Funkce neuropeptidů u většiny malých neuropřenašečů popsána poměrně záhy (množství agonistů a antagonistů, kteří mohli mimikovat jejich působení, nebo naopak simulovat jejich nedostatek)  v případě neuropeptidů množství těchto farmakologických nástrojů poněkud limitované  jen někteří z peptidergních agonistů a antagonistů procházejí přes hematoencefalickou bariéru stanovení tkáňové koncentrace neuroppetidů?  pokud je neuronální aktivita inhibována, může koncentrace neuropeptidů v tkáni růst, protože neuropeptidy se v „tichých“ buňkách akumulují  naopak, vyšší aktivita neuronů může vést až ke tkáňovému vyčerpání neuropeptidů  vzrůst nebo pokles hladiny neuropeptidů? ... mikrodialýza alespoň umožňuje přesně a přímo změřit extracelulární koncentrace neuropeptidů ve vybraných mozkových oblastech  většina prací zabývajících se funkcí neuropeptidů postavena na přímé injikaci neuropeptidů do specifických oblastí mozku či míchy  pozorování fyziologických a behaviorálních změn tímto podáním vyvolaným  injikované dávky jsou často miligramové, což je vzhledem k nannomolové afinitě neuopeptidergních receptorů nefyziologické, nicméně takto byly popsány první účinky neuropeptidů

20 Kredit: Chem Biodivers. 2012 Nov;9(11):2367-87
Receptorové typy – příklady klinické farmakologie Kredit: Chem Biodivers Nov;9(11):

21 JEDNOTLIVÉ SYSTÉMY NEUROPEPTIDŮ - opioidní peptidy
Opiodní peptidy jsou farmakologicky jedny z nejdůkladněji studovaných látek – primárně kvůli svým silným analgetickým vlastnostem, ale také kvůli svému působení proti kašli (antitussika) a průjmu (antidiarhoetika). např. morfin byl užíván už v 19. století  velká spotřeba opiátových analgetik spolu s rizikem vzniku závislosti na nich = vývoj opiátových farmak, která by závislost nezpůsobovala  ani dnes sice nelze oddělit nejúčinnější analgetické vlastnosti opiátů od těch, které navozují závislost  nicméně i tak objevení malých, lipofilních molekul jako naloxon a nalotrexon  naloxon se užívá v léčbě předávkování opiáty  nalotrexon = jehož působení je déledobější, při léčbě závislostí na opitátech a při léčbě alkoholismu  opioidní = spojeno s endogenními peptidy, které vykazují podobnou farmakologii jako opiát  opiáty = morfin a jemu příbuzná nonpeptidová analoga všechny známé opiodní peptidy jsou produkty tří velkých prekurzorových proteinů  každý z nich je kódován vlastním genem: POMC, z něhož jsou odvozeny ACTH, b-endorfin a několik nonopiodních petidů, proenkefalin, z něhož pochází met-enkefalin a leu-enkefalin a prodynorfyn, který je prekurzorem dynorfinu a jemu příbuzných proteinů naloxon

22 morfinu podobné opiáty se preferenčně váží na m receptory
 opioidní peptidy sdílejí určité stejné aminokyselinové sekvence  velmi často obsahují např. sekvenci čtyřech aminokyselin Tyr-Gly-Gly-Phe na svém N-konci, která bývá následována buď Met nebo leucinem  morfinu podobné opiátové alkaloidy z opia pravděpodobně mimikují konformaci N-koncového tyrosinu endogenních peptidů tři typy opiodních receptorů: m, k a d + NOR (orfaninový R, R pro nocicceptin)  m a d receptory jsou schopny formovat heterodimery  receptory spřaženy s G-proteiny, konkrétně s Gi/o rodinou morfinu podobné opiáty se preferenčně váží na m receptory m receptory = preferenční vazebné místo endogenních opioidních peptidů b-endorfiny  spojeny se sestupnými drahami bolest  i v jiných oblastech mozku (ventrální tegmentum, ncl. accumbens), kde jsou zodpovědné za zesílený efekt opiátů  m receptory se také vyskytují ve striatu (motorická kontrola) a l. coeruleus, ve kterém mohou vyvolávat mnohé somatické projevy závislosti na opiátech a opiátové abstinence  nejdůležitější role v supraspinální analgesii  vysoká afinita k benzomorfanové třídě opiodních látek (pentazocin) morfin pentazocin

23 JEDNOTLIVÉ SYSTÉMY NEUROPEPTIDŮ - Opiodní peptidy
d receptory jsou hlavními vazebnými partnery enkefalinů  tyto receptory nejen z zadních kořenech míšních, ale i v oblastech mozku, které nejspíše nehrají v nocicepci žádnou úlohu  klinické využití agonistů d receptorů zatím není známo k receptory = vykazuje k nim nejvyšší afinitu dynorfin  k- prefix od prototzpického agonisty ketocyklazocinu  tyto peptidy se ovšem váží s různou afinitou ke všem třídám opiodních Rs nociceptiny (orphaniny) = látky se zajímavými antiopioidní efekty  váží se na receptory spřaženéné s G-proteiny, které vykazují vysokou míru homologie s receptory opioidními  zvyšují vnímavost k bolestivým stimulům  v hypothalamu, mozkovém kmeni, koncovém mozku, obou rozích míšních ketocyklazocin orphanin FQ 17 AA

24 Kortikotropin uvolňující faktor (corticotropin-releasing factor (CRF)
 CRF = peptid o délce 41 aminokyselin  prvně izolován jako hypothalalmický faktor napomáhající podobně jako vasopressin sekreci ACTH (sekvenován prvně u ovcí, 1981)  syntetizován populací neuronů paraventrikulárního jádra hypothalamu  odtud uvolňován do portálního spojení s hypofýzou  nejen secernován do této portální cirkulace - neurony paraventrikulárního jádra hypothalamu projkují do různých mozkových struktur  syntetizován také mimo hypothalamus, např. v centrálním jádře amygdaly  sekvence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA  CRF uvolňovaný z amygadaly hraje kritickou roli v odpovědi mozku na stres  zřejmě přispívá i ke vzniku pocitů strachu a úzkosti  částečně zodpovědný za negativní projevy odvykacího syndromu závislých jedinců  může být také zapojen do long-term deprese v mozečku  dva subtypy CRF receptorů. CRF1 R je široce exprimován v celém mozku. Jeho antagonisté mohou sloužit jako látky v terapii úzkosti a deprese. CRF2 R je koncentrován v bočních jádrech septa. Laterální septum je spojeno s emocemi, strachem a kognitivními funkcemi. Endogenním ligandem CRF2 R je urocortin (a urocortin II, jemu příbuzný).

25 Tachykininy  substance P, neurokinin A (NKA, dříve označovaný jako substance K) a neurokinin B (NKB), kassinin, eledoisin = tachykininy  všechny tachykininy sdílejí stejnou C-koncovou sekvenci Phe-X-Gly-Leu-Met-NH2  substance P a NKA kódovány genem pro preprotachykinin A  vznikají alternativním sestřihem  NKB je kódován genem pro preprotachykinin B  všechny známé tachykininové receptory jsou spřažené s Gq proteiny  označovány jako NK1, NK2 a NK3 receptory  substance P vykazuje nejvyšší afinitu k NK1 receptoru, NKA preferenčně váže NK2 receptor a NKB zejména NK3 receptory

26 Substance P a neurokinin A
 substance P: už v 70. letech se věřilo, že by mohla být hlavním transmiterem nocicepce  synapse primárních aferentních noiceptorů zadních kořenů míšních obsahují značné množství neuropeptidů, z nichž nejhojnější jsou calcitonin gene-related peptid (CGRP), ! substance P a NKA  substance P v nocicepčních C vláknech kolokalizována s glutamátem  její výlev z velkých denzních váčků vyžaduje silnější stimulus, než který by stačil pro klasický výlev glutamátu  uvolňuje se i retrográdně z volných nervových zakončení nocicepčních neuronů  přispívá k fenoménu neurogenního zánětu, při kterém interaguje s peptidem bradykininem  myši knock-outované pro NK1 receptor nebo gen pro preprotachykinin A: nevykazovaly projevy neurogenního zánětu, ale jejich nocicepce byla omezena jen v určitých nocicepčních drahách  žádnou změnu oproti přirozenému fenotypu např. nevykazovaly v mechanické hypersenzitivitě navozené zánětem  deficity v nocicepci vykazovaly jen při aplikaci nocicepčních stimulů se vzrůstající intenzitou Roli substance P v nocicepci tedy evidentně mohou přebírat i jiné nocicepční neuropřenašeče.  substance P a NK1 Rs se nacházejí v amygdale  antagonista NK1 Rs v pokusech prováděných na mládětech morčat izolovaných od matky snižoval zvukové projevy jejich stresu  antagonisté NK1 Rs testováni jako antidepresiva a anxiolytika; slibní i v léčbě chemotarapií navozené nausey (oproti antagonistům 5-HT3 receptorů (ondasetron) blokují nejen časnou, ale i pozdní fázi tohoto fenoménu)

27 Antagonisté NK1 Rs - ANTIEMETIKA
Aprepitant Antagonisté NK1 Rs: potenciální analgetika potenciální antidepresiva potenciální hypnotika možná role v etiologii bipolární poruchy (studie z r. 2008, Arch. Gen. Psychiatry 65 (1): 53–61 )

28 Byly naklonovány i NTS2 a NTS3 (=sortilin, mikroglie) receptory.
Neurotensin (NT) peptid o délce 13 aminokyselin  vzniká z prekurozru obsahujícího také peptid neurotensinu podobný 6 aminokyselin)  NT exprimován v mozku, nadledvinách a střevu, a to v mírně odlišných formách podle své tkáňové distribuce  jeho C-konce obsahuje alternativně jednu ze tří Lys-Arg sekvencí, které jsou podle typu tkáně rozdílně štěpeny  v mozku z prekurzoru vzniká NT a neuromedin N  v nadledvinách vzniká delší forma neuromedinu N, neurotensin a jeho o něco delší štěpný produkt  ve střevu vzniká NT a delší forma neuromedinu N  dva typy receptorů pro neurotensin : NTS1 a NTS2 receptory  NTS1 mRNA je produkována v substantia nigra, ale ne ve striatu  kupodivu, vlastní protein NTS1 receptorů se na dopaminergních terminálách striata nachází  NT tak zřejmě moduluje dopaminergní transmisi  exprese mRNA pro neurotensin je ve striatu vyvolaná antagonisty D receptorů, z nichž mnohé souží jako antipsychotika a nebo psychostimulační drogy (kokain, amfetamin) Byly naklonovány i NTS2 a NTS3 (=sortilin, mikroglie) receptory. neurotensin

29 Neuropeptid Y (NPY) jedním s řady navzájem příbuzných peptidů, které tvoří rodinu pankreatických polypetidů  36 AA  izlován r  jejími dalšími členy jsou pankreatický polypeptid (PP) a polypeptid YY (PYY)  NPY je nejhojnějším neuropeptidem mozkové kůry  koncentrován je i zadních rozích míšních a v hypothalamu  v sympatiku i v CNS bývá kolokalizován s noradrenalinem NPY a jemu peptidy se u savců váží na receptory označované Y1 až Y (u lidí jen čtyři - Y1, Y2 , Y4, Y5) receptory vykazují různou afinitu pro NPY, PP i PYY  nacházejí se presynapticky i postsynapticky v různých oblastech mozku  aktivace Y1 receptoru zřejmě souvisí s poklesem úzkostného chování, asi na úrovni amygdaly a kůry mozkové  agonisté Y1 receptoru by mohla být slibná anxiolytika, a vykazují i určitý antinocicepční efekt  naproti tomu aktivace Y5 receptoru vede ke zvýšení příjmu potravy (nejspíše na úrovni hypothalamu)  antagonisté Y5 receptorů by tedy mohli být úspěšní v léčbě obezity NPY

30 PURINY Puriny nejsou jen stavebními kameny RNA a DNA, metabolickými kofaktory nebo druhými posly jako cAMP nebo cGMP. Hrají také důležitou roli v signalizaci mezi neurony. Biochemie purinů  dusíkaté heterocykly tvořené kondenzovaným pyrimidinovým a imidazolovým kruhem  v purinergní transmisi využívány nukleosidové a nukleotidové deriváty samotného purinu  v nukleových kyselinách jsou využívány dva purinové deriváty (adenin a guanin)  v rámci signalizace mezi neurony využívány hlavně adenosin a ATP  využíván i jim příbuzný je adenindinukleotid (ApnA) = molekula sestávající ze dvou adenosinů kovalentně spojených řetězcem dvou až šesti fosfátů.  na neurotransmisi se do určité míry mohou podílet i nukleotidové deriváty pyrimidinového typu guanin adenin

31 Skladování a výlev purinů
 adenosin a ATP/ApnA vykazují i odlišné vlastnosti  ATP a ApnA skladovány v malých synaptických váčcích a uvolňovány exocytosou navozenou depolarizací a vtokem Ca2+ do zakončení  často jsou také detekovány ve stejných synaptických váčcích na stejné synapsi  adenosin uvolňován z nonvesikulárních cytoplasmatických zásob  mimo cytoplasmu jej mohou uvolňovat obousměrné nukleosidové transportéry  může vznikat rovnou v synaptické štěrbině, kam je uvolňován ve formě ATP a během sekundy metabolizován  na membráně navázaná ectodiphosphohydrolasa konvertuje ATP na ADP a AMP  AMP rozpustnou či s membránou asociovanou ecto-5´-nukleotidasou konvertován na adenosin  výlev ATP tedy rovněž může být vydatným zdrojem extracelulárního adenosinu  ApnA je hydrolyzován pomaleji a zůstává v synaptické štěrbině delší dobu Purinové transportéry  nukleosidové transportéry = k membráně vázané proteiny sloužící k přenosu purinových a pyrimidinových nukleosidů dovnitř a ven z mnoha typů buněk  liší se svou substrátovou specifitou (jsou purin- nebo pyrimidinselektivní)  některé koncentrují nukleosidy v buňce v závislosti na Na+  jiné transportují nukleosidy ve směru jejich koncentračního gradientu

32 Purinové transportéry
jiné transportují nukleosidy ve směru jejich koncentračního gradientu  farmakologicky bylo odlišeno nejméně sedm nukleosidových transportérů  čtyři i klonováni  u lidí 3 koncentrační transportéry (CNT - přenáší proti gradientu; AZT!)  4 ekvilibrační (ENT – v obou směrech), jejich inhibitory (dilazep) jsou vazodialtancia i farmakologie CNT zahrnuje některé terapeuticky využitelné látky: • několik chemoterapeutik nádorového bujení (gemcitabin) a • silná antivirotika jako zidovudin (AZT) či Zalcitabin, užívané v léčbě AIDS  obvykle nukleosidové analogy  potenciálně i farmaka užitečná v léčbě neuropsychiatrických poruch Kredit:Mol Aspects Med Apr-Jun;34(2-3):529-47

33 Charakteristiky některých purinových Rs
Blood Sep 20;120(12): purinergní signalizace se objevuje už u bakterií, améb, bičíkovců, řas, hub, žahavců, žebernatek, ploštěnců, hlístic, korýšů, měkkýšů, kroužkovců, ostnokožců a hmyzu u rostlin zvyšuje extracelulárně podané ATP a jiné nukleotidy cytoplasmatickou koncentraci vápníku, čímž ovlivňuje růst rostliny a její odpověď na různé stimuly

34

35 P1 receptory = adenosinové receptory A1, A2A, B a A3
Purinové receptory Purinové receptory tvoří relativně velkou a různorodou skupinu proteinů, dělenou do dvou hlavních podskupin, označovaných jako P1 a P2 receptory. P1 receptory = adenosinové receptory A1, A2A, B a A3 P2 receptory = dvě rodiny zástupců • P2Y receptory spřažené s G-proteiny a • P2X receptory, které jsou ligandem ovládané iontové kanály P1 receptory = adenosinové receptory A1, A2A, B a A3 .  váží adenosin a jeho analoga  spřaženy s G-proteiny  vyklonovány čtyři subtypy  A1 subtyp je nejrozšířenější v mozku a v páteřní míše  nejvyšší afinitu vykazuje k adenosinu  aktivace A1 subtypu  anxiolytické, antikonvulzivní, analgestické a sedační účinky adenosinu  antagonisté A1 receptoru  stimulační efekty  v nižších dávkách např. zvyšují pozornost (kofein), ve vyšších dávkách vyvolávají pocity úzkosti a podráždění kofein

36 A2 receptorů vyklonovány dva podtypy: A2A a A2B  k adenosinu mají poněkud nižší afinitu než A1 receptor  A2B receptory široce rozšířené v celém lidském těle  jejich exprese v mozku a páteřní míše je ale nízká  oproti nim jsou A2A receptory vysoce koncentrovány v zadním striatu, ncl accumbens a čichovém laloku - třemi mozkovými oblastmi s dopaminergní inervací  interakce dopaminu a adenosinu jsou v těchto oblastech popsány  ve striatu agonisté A2A receptorů inhibují odpovědi navozené D2 receptory  naopak antagonisté je mimikují – i to přispívá se stimulačním účinkům kofeinu a jiných methylxanthinů  antagonizací A2A Rs kofein redukuje klidový tok cerebrálními arteriemi o 22-30%  inverzní působení A2A a D2 receptorů by snad mohlo být užitečné v terapii Parkinsonovy choroby metabolity kofeinu

37 A3 receptor v nízkých hladinách exprimován v mozku
 jeho funkce v mozku zatím není do detailů popsána (možná role v neuroprotekci i neurodegeneraci) má neuroprotektivní i neurodegenerativní efekty, může posilovat buněčnou proliferaci i smrt kardioprotektivní funkce během srdeční ischemie (selektivní agonista CP532,903) antagonista SSR by mohl být vhodný pro terapii bronchiálního astmatu agonista CF-101 v klinických pokusech léčby revmatické artritidy (genericky IB-MECA, hotová je fáze II, stejně jako fáze II psoriatické studie) a tzv. syndromu suchého oka (keratoconjunctivitis sicca, fáze III) ze všech adenosinových receptorů vykazuje k adenosinu nejnižší afinitu zatímco A1 a A2 receptory váží adenosin s nanomolární afinitou, A3 receptor potřebuje mikromolární koncentrace

38  P2Y receptory spřažené s G-proteiny a  vyklonováno 14 P2Y receptorů  váží difosfáty i trifosfáty purinových i pyrimidinových nukleotidů, stejně jako ApnA  afinita k různým ligandům se liší  např. P2Y1 receptor váže ATP a ADP, ale ne UTP nebo UDP  naopak, P2Y2 receptor je aktivován ATP i UTP se stejnou potencí  oba P2Y1 i P2Y2 receptory byly detekovány v mozku Nomenklatura P2Y receptorů je poněkud zmatečná, protože některé subtypy, u kterých se mělo za to, že jsou naklonovány, naklonovány vlastně nebyly :) P2Y receptory Všimněte si, že P2Y3, P2Y5, P2Y7, P2Y8 a P2Y9 , receptory vlastně nejsou ;)

39 Ionotropní purinergní receptory (P2X R)
P2X receptorů bylo charakterizováno subtypů  u člověka se nacházejí zejména na chromosomech 12 a 17  kationtové kanály aktivované ATP nebo ApnA  sestávají z více podjednotek  dva transmembránové segmenty s C- i N- koncem v cytoplasmě (podobně jako mechanosensitivní kanály vláskových buněk nebo epitheliální Na+ kanály obratlovců)  nejspíše trimery, TM2 segment tvoří vnitřní pór  in vitro formují homomery s výjimkou P2X6 podjednotky  fuknční kanál obvykle heteroromer  extracelulární smyčky spojené disulfidickými můstky  Na+, K+, Ca2+ evolučně primitivní a nezávisle oddělená receptorová rodina

40 Trimer P2X receptoru se 3 molekulami ATP
Kredit:

41 aktivace P2X receptorů  rychlé toky Na+, K+ a Ca2+  depolarizace buňky  vyskytují se na periferii, na nervosvalovém spojení, v míše i mnoha oblastech mozku  ovlivňují srdeční rytmus, cévní a svalový tonus, kontrakci vas deferens při ejakulaci nebo nocicepci  overexprese P2X4 Rs v míše vede k hypersensitizaci  P2X4 a 7 Rs citlivé na makrocyklický lakton ivermectin (zvyšuje jejich vodivost a zvyšuje pravděpodobnost otevření kanálu – pozitivní allosterický modulátor) P2X4 R

42 Funkce purinů  připisovaná celá řada funkcí, ale jen některé byly s určitostí potvrzeny  adenosin má anxiolytické a hypnotické vlastnosti, což potvrdilo i podávání antagonistů adenosinových receptorů  kofein a jiné methylxanthinové sloučeniny zvyšují bdělost a kognici  antagonisté purinergních receptorů by mohli být využívání jako podpůrná léčba symptomů u deficitů spojených a Alzheimerovou chorobou a jinými formami demence Neuroprotekční účinky adenosinu: např. po mozkové mrtvici.  mrtvici doprovází ischemie spojená se zvýšením koncentrace glutamátu  ten navozuje masivní vtok Ca2+ do buněk a jejich excitotoxickou smrt  ideální neuroprotektivum: • za ischemických podmínek inhibuje presynaptický výlev glutamátu • zabraňuje depolarizaci postsynaptické membrány a vtoku Ca2+ do postsynaptické buňky  adenosin vyhovuje oběma parametrům  aktivace presynaptických A1 receptorů adenosinem blokuje výlev glutamátu  aktivace postynaptických A1 receptorů otevírá draslíkové a chloridové kanály a vede k hyperpolarizaci membrány  celkový výsledek: snížený vtok vápníku a nižší úmrtnost neuronů  pokusy na zvířecích modelech tuto hypotézu potvrzují

43 Adenosinová signalizace v léčbě Parkinsonovy nemoci?
 podání selektivníh agonistů A1 receptorů bezprostředně před ischemickou atakou nebo v jejím průběhuu  významné snížení ztráty neuronů a chrání před následnými deficity paměti  naopak, podávání selektivních antagonistů ischemické poškození mozku zhoršuje !POZOR! – množství adenosinu se v mozku během ischemie dramaticky zvyšuje  aktivace A1 receptorů může být do určité míry neuroprotekční, na jiných subtypech purinergních receptorů vyvolává opačný efekt  aktivace A2 receptorů na modely mozkové mrtvice  výrazně negativní dopad  podávání selektivní antagonistů A2 receptorů působilo neuroprotekčně  stejně tak bezprostřední aktivace A3 receptorů výrazně zvyšovala u pokusných zvířat poškození mozku a úmrtnost  kupodivu, dlouhodobé podávání téhož farmaka mělo efekt naprosto opačný  na různorodosti těchto pozorování se zřejmě podílí vliv adenosinu na cévní tonus a agregaci krevních destiček Adenosinová signalizace v léčbě Parkinsonovy nemoci?  ve striatu poměrně hojně exprimovány A2A receptory  inhibují odpovědi navozené D2 receptory a naopak antagonisté je mimikují – aktivace A2A receptorů navozuje pokles motorické aktivity  inverzní působení A2A a D2 receptorů by snad mohlo být užitečné v pomocné terapii alespoň těchto projevů  popsáno několik látek, které při perorálním podání selektivně blokují A2A receptory  při současném podávání s L-dopa snižují její vedlejší účinky  u některých parkinsonických pacientů může zmírňovat dyskinesii i theofylin theofylin

44 Role purinů v modulaci imunitní odpovědi
cestou aktivace P2X7 receptorů dochází k poklesu intracelulární hladiny draslíku a formování tzv. inflamosomu autokrinní purinergní signalizace = důležitý kontrolní bod při aktivaci leukocytů puriny mohou (v závislosti na cytokinovém okolí) fungovat imunosupresivně i imunostimulačně Roli hraje také koncentrace ATP: mM koncentrace aktivují A2A a A2B receptory, což vede k inhibici výlevu granulí z neutrofilů a zabraňuje oxidativnímu vzplanutí X nM koncentrace ATP naopak stimulují A1 receptory, což vede k chemotaxi neutrofilů do místa zánětlivého stimulu.

45 adenosin a ATP slouží také jako mediátor v komunikaci neuron-glie
Role purinů v CNS adenosin a ATP slouží také jako mediátor v komunikaci neuron-glie oba indukují proliferaci astrocytů v mikrogliích jsou exprimovány P2X i P2Y receptory P2Y6 receptor, zprostředkovávající primárně odezvu na UDP, hraje důležitou roli ve fagoptóze mikroglií a jejich proliferaci P2XR receptory jsou zapojeny do drah neuropatické bolesti P2Y12 receptor = specializovaný pattern recognition receptor (receptor rozpoznávající vzorec/motiv), např. molekulární vzorec patogenity v rámci imunitní odpovědi ve frontální kůře mozku pacientů s Alzheimerocou chorobou byla prokázána zvýšená hladina A1 a A2A receptorů, zatímco hladina A1 receptorů ve vnější vrstvě gyrus dentatus hippokampu byla snížena Kredit:

46 Kredit: J Neurochem. 2014 Mar;128(5):650-61

47 Role purinů v antikoalulaci
agonisté zejména P2Y12 receptoru Prasugrel, Ticagrelor nebo Ticlopidin Clopidogrel (prodáván jako Plavix = dříve celosvětově druhý nejpředepisovanější přípravek musí být v organismu aktivován CYP2C19 v játrech 2-14% US populace má sníženou hladinu tohoto jaterního enzymu nižší účinnost a vedlejší účinky Prasugrel tímto netrpí Clopidogrel Prasugrel

48 Co si pamatovat z dnešní přednášky
neuropeptidy: klasifikace neuropeptidy: vznik a a proteolytické štěpení neuropeptidy: rozdíly v signalizaci oproti „klasice“ neuropeptidy: funkce puriny: skladování a výlev puriny: receptorové třídy puriny: příklad farmakologie receptorů


Stáhnout ppt "Neuropřenašeče: neuropeptidy a puriny"