Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

Dynamika exprese mRNA Sak, Polo kinázy 4, během růstu a zrání prasečího oocytu Autor: Milan Blaha Konzultant: Prof. MVDr. Jan Motlík, DrSc. Škola: Havlíčkovo.

Podobné prezentace

Prezentace na téma: "Dynamika exprese mRNA Sak, Polo kinázy 4, během růstu a zrání prasečího oocytu Autor: Milan Blaha Konzultant: Prof. MVDr. Jan Motlík, DrSc. Škola: Havlíčkovo."— Transkript prezentace:

1 Dynamika exprese mRNA Sak, Polo kinázy 4, během růstu a zrání prasečího oocytu Autor: Milan Blaha Konzultant: Prof. MVDr. Jan Motlík, DrSc. Škola: Havlíčkovo gymnázium Havlíčkův Brod Pracoviště: Ústav živočišné fyziologie a genetiky Akademie věd České republiky Liběchov

2 Úvod  Polo kinázy – důležité regulátory buněčného cyklu, mitózy, meiózy i diferenciace všech eukaryot charakteristické (krom Plk4) dvěma polo-boxy na C-konci.  Plk4 obsahuje jen jeden polo-box a 3 PEST sekvence.  První objevena v 80. letech 20. století u mutace polo Drosophily.  Známe 4 Polo kinázy savců: Plk1, Plk2 (Snk), Plk3 (myší Fnk, lidská Prk), Plk4 (Sak, Stk18)  Oocyt – neocenitelný model pro studium buněčného cyklu  Prasečí model je v mnohém výhodnější než myší.

3 Plk4 (Sak) Dvě izoformy (Sak-a – 104 kDa, Sak-b – 53 kDa) – odlišná fukce. Dvě izoformy (Sak-a – 104 kDa, Sak-b – 53 kDa) – odlišná fukce. Protein i mRNA v proliferujících buňkách v S-G2-M, důležitá role v embryogenezi, indikátor proliferační aktivity. Protein i mRNA v proliferujících buňkách v S-G2-M, důležitá role v embryogenezi, indikátor proliferační aktivity. Nutná pro APC-dependentní ubiquitinaci cyklinu B1. Nutná pro APC-dependentní ubiquitinaci cyklinu B1. Nadměrná exprese inhibuje buněčný růst, regulace funkce Sak-a je nezbytná pro korektní duplikaci centrozomů a regulaci mitotických struktur během buněčného dělení. Nadměrná exprese inhibuje buněčný růst, regulace funkce Sak-a je nezbytná pro korektní duplikaci centrozomů a regulaci mitotických struktur během buněčného dělení. Poruchy duplikace centrozomů byly zjištěny i u Plk4-/+ buněk a ukazují na možnou spojitost s p53. Poruchy duplikace centrozomů byly zjištěny i u Plk4-/+ buněk a ukazují na možnou spojitost s p53. V lidských leukocytech je její exprese indukována Tec, která aktivuje c-Fos transkripční faktor. V lidských leukocytech je její exprese indukována Tec, která aktivuje c-Fos transkripční faktor. Inaktivace c-fos inhibuje růst buněk, ale mutace způsobuje růst nadměrný. AP-1 vazebný motiv je v promotoru sak. Inaktivace c-fos inhibuje růst buněk, ale mutace způsobuje růst nadměrný. AP-1 vazebný motiv je v promotoru sak.

4 Cíle Určení parciální sekvence cDNA pro Plk4 exprimovanou v prasečím oocytu a analýza této sekvence Určení parciální sekvence cDNA pro Plk4 exprimovanou v prasečím oocytu a analýza této sekvence Zjištění dynamiky exprese mRNA pro Plk4 během růstu a zrání prasečího oocytu Zjištění dynamiky exprese mRNA pro Plk4 během růstu a zrání prasečího oocytu Efekt  -amanitinu na tuto expresi Efekt  -amanitinu na tuto expresi

5 Metody Izolace a kultivace oocytů, granulózních a kumulárních buněk Izolace a kultivace oocytů, granulózních a kumulárních buněk Izolace totální RNA pomocí RNeasy Mini Kit® (QIAGEN) Izolace totální RNA pomocí RNeasy Mini Kit® (QIAGEN) RT a PCR RT a PCR Molekulární klonování v plazmidických vektorech pomocí TA Cloning Kit® (Invitrogen) Molekulární klonování v plazmidických vektorech pomocí TA Cloning Kit® (Invitrogen) Izolace plazmidické DNA pomocí QIAGEN® Plasmid Midi Kit Izolace plazmidické DNA pomocí QIAGEN® Plasmid Midi Kit Sekvenace Sak-inzertu (BigDye® Terminator v3.1 Cycle Sequencing Kit a sekvenátor ABI PRISM 310, AB) Sekvenace Sak-inzertu (BigDye® Terminator v3.1 Cycle Sequencing Kit a sekvenátor ABI PRISM 310, AB) Kvantifikace množství mRNA pomocí jednokrokové Real-Time RT-PCR Kvantifikace množství mRNA pomocí jednokrokové Real-Time RT-PCR

6 Výsledky - analýza parciální sekvence prasečí Plk4 Po odfiltrování sekvencí vektoru a primerů navržených na myší sekvenci získáváme úsek cDNA, který kóduje tuto sekvenci 343 AA: Po odfiltrování sekvencí vektoru a primerů navržených na myší sekvenci získáváme úsek cDNA, který kóduje tuto sekvenci 343 AA: OrganismusHomologie Pes78% Šimpanz77% Člověk77% Kur65% Myš62% Drápatka48% VEIQQNRLSLSSVLDHPFMSRNSSTKNKDLGTVED SIDSGHATISTAITASSSTSICGSLFDRRKLLIDQ PLPNKVTIFPKNKNSSDFTSSGDRSSFYTQWGNQE QETSNSGRGRIIQEAEERPHSRYLRRAHSSDRSGT SNQSRAKTYTMERCHSAEMLSKSKRSGVDENEEGY SPTNSNANIFNVFKEKTSSGSGSFEGPDNNQALSN HLCPGKTPFPFPDQTAQTEMVQQWFGNLQIHDPFS EQSKTRGTEPPLGYQKRTLRSITSPLTAYRLKPIR QKTKKAVVSILDSEEVCVELLKEFASQEYVKEVLQ ISSDGSMITIYYPNDGRGFPLADRPPSP Na lidské sekvenci se jedná o AA: 247-485 a 564-665 1. Konec kinázové domény 2. PEST1 3. Sek. charakteristická pro Sak-a 4. Začátek domény interagující s Tec a Sak kinázovou doménou

7 Výsledky – dynamika exprese Vzorky: 1 – rostoucí oocyty s průměrem 80  m; 2 – rostoucí oocyty s průměrem 100  m; 3 – FG oocyty (120  m) v GV; 4 – FG oocyty (120  m) v M-I; 5 – FG oocyty (120  m) v M-II VzorekPoměr (objem) Poměr (oocyty) 11,000 21,2552,452 30,4691,584 40,4521,526 50,4201,416

8 Výsledky – efekt  -amanitinu  -amanitin – inhibitor exprese RNA, váže se na RNA-polymerázu II a III, čímž inhibuje jejich elongační krok. Byla užita koncetrace 10 ng/ml média.  -amanitin – inhibitor exprese RNA, váže se na RNA-polymerázu II a III, čímž inhibuje jejich elongační krok. Byla užita koncetrace 10 ng/ml média. Vzorky: 1.rostoucí oocyty s 80  m v průměru bez kultivace v  -amanitinu 2.rostoucí oocyty s 80  m v průměru kultivované v  -amanitinu po dobu 8 hodin 3.rostoucí oocyty s 80  m v průměru kultivováné v  -amanitinu po dobu 20 hodin 1,000 1,384 0,885 0,000 0,200 0,400 0,600 0,800 1,000 1,200 1,400 1,600 123 Vzorek Poměr

9 Výsledky – efekt  -amanitinu na expresi referenčních genů 1,000 0,363 0,278 0,000 0,200 0,400 0,600 0,800 1,000 1,200 123 Vzorek Poměr Efekt stejné koncentrace (10 ng/ml kultivačního média)  -amanitinu byl zkoumán na prasečích kumulárních buňkách (PCC) na expresi  -aktinu a histonu 2A.  -aktin Histon 2A Vzorky: 1 – prasečí kumulární buňky (PCC ) bez kultivace v  -amanitinu; 2 – PCC kultivované v  -amanitinu po dobu 8 hodin, 3 – PCC kultivované v  -amanitinu po dobu 20 hodin

10 Diskuse  Sak také pravděpodobně sehrává již dříve diskutovanou roli v APC dependentní degradaci cyklinu B.  Stabilizovaný Sak transkript tvoří zásobu mRNA pro transkripčně neaktivní embryonální stádia.  Efekt  -amanitinu se v oocytu zpožďuje díky jeho velikosti a intenzivní expresi Sak.  Je třeba identifikovat Sak protein, jeho aktivitu během růstu a zrání oocytu, vztah k AP-1, c-Fos a APC. Růstový faktor (cytokin) G-protein Tec c-Fos Sak-a

Stáhnout ppt "Dynamika exprese mRNA Sak, Polo kinázy 4, během růstu a zrání prasečího oocytu Autor: Milan Blaha Konzultant: Prof. MVDr. Jan Motlík, DrSc. Škola: Havlíčkovo."

Podobné prezentace

Reklamy Google