Prezentace se nahrává, počkejte prosím

Prezentace se nahrává, počkejte prosím

Stránky praktika (http://www.natur.cuni.cz/~muncling)

Podobné prezentace


Prezentace na téma: "Stránky praktika (http://www.natur.cuni.cz/~muncling)"— Transkript prezentace:

1 Stránky praktika (http://www.natur.cuni.cz/~muncling)

2 Počítačová část Genetické metody v zoologii Dopolední část: (Pavel Munclinger, Václav Janoušek) - Databáze sekvencí - Manipulace se sekvencemi - Navržení primerů pro PCR - Celogenomová data Odpolední část: (Zuzana Starostová, Petr Synek) - Fylogenetická analýza

3 Kde se dozvědět více? Kurz Computational Genomics (Marc VanRanst) Bioinformatics bookmarks (http://www.kuleuven.ac.be/rega/mvr/bioinformatics.htm) Úvod do bioinformatiky/Základy bioinformatiky (F. Cvrčková) Molekulární ekologie (letní semestr, populační genetika, analýza paternity)

4 Databáze sekvencí Primární databáze DNA sekvencí RefSeq Genomové databáze

5 Primární databáze DNA sekvencí International Nucleotide Sequence Databases (INSD) GenBank (National Center for Biotechnology Information) USA DNA Data Bank of Japan (DDBJ) (National Institute of Genetics) Japan European Nucleotide Archive (European Bioinformatics Institute) Europe Your submission

6 RefSeq: Databáze unikátních sekvencí Provozována NCBI Kurátorovaná databáze založená na sekvencích získaných z primárních databázích Unikátní sekvence genu/transkriptu/proteinu pro jednotlivé organismy/ekomorfy/varianty

7 Genomové databáze Skladují anotované assembly celých genomů + veškerá metadata asociovaná se sekvencemi nebo geny/transkripty/ proteiny: Sekvence, geny, transkripty, proteiny, proteinové rodiny, paralogy, orthology, mezidruhové alignmenty, genové exprese, varianty (SNPs), repetitivní elementy, mikrosatelity, strukturální změny, genová regulace, fenotypy apod.

8 Genomové databáze Veškerá data jou vzájemně propojena pomocí identifikátorů a pozic v genomech: SekvenceGen TranskriptExpreseFunkce

9

10 Manipulace se sekvencemi Uchovávání sekvencí Alignment BLAST

11 Uchovávání sekvencí Sekvence uchovávány ve formě textu v klasickém textovém souboru (možno editovat v notepadu, textpadu, apod. nebo ve specifických programech určených k manipulaci a editaci sekvencí – např. BioEdit) V textových souborech uchovávány ve specifickém tvaru: –FASTA (.fa,.fas,.fasta) –GenBank (.gb) V každém souboru 1 i více sekvencí

12 FASTA >gi| |gb|EF | Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial ATGACCCACATCCGAAAATCCCACCCCTTATTCAAAATTATCAACGACTCATTCATCGACCTACC AGCTCCATCAAACATTTCCTCCTGATGAAATTTTGGGTCCCTACTAGGTATTTGTTTAGCTGTAC AAATCTTAACAGGACTGTTCCTAGCAATACATTATACATCAGATACCACAACCGCCTTCTACTCT GTTACCCATATCTGCCGAGACGTAAATTACGGCTGAATCCTACGTTACCTCCATGCCAACGGAGC ATCCATATTCTTCATCTGCCTATTTATACATGTAGGCCGAGGCATCTATTACGGCTCATACCTAT TCACAGAAACATGAAACATTGGCATTATCCTTCTATTCGCCGTAATAGCAACAGCATTCATAGGC TATGTCCTCCCA >gi|... ATGA... Pouze velmi základní informace o sekvenci – formát určen primárně k manipulaci se sekvencemi

13 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // GenBank Formát uchovává velmi detailní informaci o sekvenci – určen k uchovávání sekvencí vč. veškerých informací asociovaných se sekvencí

14 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // Základní vlastnosti sekvence (název, délka, typ) LOCUS

15 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // Výpis genů v sekvenci DEFINITION

16 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // Databázové přístupové číslo ACCESSION VERSION Verze dané sekvence

17 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // KEYWORDS Pod kterými klíčovými slovy ji lze najít

18 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // SOURCE Organismus + zařazení v systému

19 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // REFERENCE Článek(y), kde byla daná sekvence publikována + autoři

20 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // FEATURES Podrobný popis jednotlivých genů včetně jejich pozic – např. počátek a konec kódující sekvence, sekvence proteinu + XREFS Pozice genu v rámci sekvence

21 LOCUS EF bp DNA linear MAM 15-OCT-2007 DEFINITION Rhinopoma hardwickei haplotype 2949 cytochrome b gene, partial cds; mitochondrial. ACCESSION EF VERSION EF GI: KEYWORDS. SOURCE mitochondrion Rhinopoma hardwickii (Lesser mouse-tailed bat) ORGANISM Rhinopoma hardwickii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinopomatidae; Rhinopoma. REFERENCE 1 (bases 1 to 402) AUTHORS Hulva,P., Horacek,I. and Benda,P. TITLE Molecules, morphometrics and new fossils provide an integrated view of the evolutionary history of Rhinopomatidae (Mammalia: Chiroptera) JOURNAL BMC Evol. Biol. 7, 165 (2007) PUBMED REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 402) AUTHORS Hulva,P. TITLE Direct Submission JOURNAL Submitted (18-FEB-2007) Zoology, Charles University, Vinicna 7, Prague, , Czech Republic FEATURES Location/Qualifiers source /organism="Rhinopoma hardwickii" /organelle="mitochondrion" /mol_type="genomic DNA" /db_xref="taxon:124756" /haplotype="2949" CDS 1..>402 /codon_start=1 /transl_table=2 /product="cytochrome b" /protein_id="ABR " /db_xref="GI: " /translation="MTHIRKSHPLFKIINDSFIDLPAPSNISSWWNFGSLLGICLAVQ ILTGLFLAMHYTSDTTTAFYSVTHICRDVNYGWILRYLHANGASMFFICLFMHVGRGI YYGSYLFTETWNIGIILLFAVMATAFMGYVLP" ORIGIN 1 atgacccaca tccgaaaatc ccacccctta ttcaaaatta tcaacgactc attcatcgac 61 ctaccagctc catcaaacat ttcctcctga tgaaattttg ggtccctact aggtatttgt 121 ttagctgtac aaatcttaac aggactgttc ctagcaatac attatacatc agataccaca 181 accgccttct actctgttac ccatatctgc cgagacgtaa attacggctg aatcctacgt 241 tacctccatg ccaacggagc atccatattc ttcatctgcc tatttataca tgtaggccga 301 ggcatctatt acggctcata cctattcaca gaaacatgaa acattggcat tatccttcta 361 ttcgccgtaa tagcaacagc attcataggc tatgtcctcc ca // ORIGIN Sekvence Konec sekvence

22 Příklad GenBank na stránkách NCBI – ve vyhledávání možnosti “Nucleotide” - GenBank + RefSeq Vyhledávání podle rodového názvu “Mammuthus” Velké množství záznamů – omezit výběr pouze na neredundantní databázi RefSeq Celý genom – použít webový formulář k výběru pouze sekvence cytochromu b (pozice v části SOURCE – CDS) Vyhledejte sekvence cytochromu b ze všech druhů mamutů, které byly osekvenovány (jaké druhy?) Exportujte protein-kódující část do FASTA formátu a uložte na počítač Postup:

23 Porovnání sekvencí: Alignment Porovnání/přiřazení dvou a více sekvencí Při alignmentu předpokládána homologie sekvencí Využívány různé typy algoritmů = různé předpoklady Sekvence se shodují Sekvence se liší Sekvence chybí

24 Pairwise Alignment (2 sekvence) –Globální (Needleman-Wunsch): Zhruba stejně dlouhé sekvence Snaží se přiřadit od začátku až do konce sekvence –Lokální (Smith-Waterman): Jen nejlépe shodující se místa obou sekvencí Sekvence různě dlouhé Např. BioEdit Typy alignmentů

25 Multiple Alignment –Více sekvencí –Hledá konzervativní místa –ClustalW, Muscle, T-coffee Např. BioEdit, sms2/index.html

26 Uchovávání alignmentů Podobně jako v případě sekvencí – v textových souborech ve specifickém formátu Různé formáty: nejčastěji formát programu ClustalW (.aln) lze také jako multiple FASTA Phylip (.phy), NEXUS (.nex) – odpoledne Nově SAM (Sequence Alignment/Map format) – velké celogenomové alignmenty

27 BLAST Basic Local Alignment Search Tool Vyhledávání v databázích sekvencí na základě podobnosti Algoritmus hledá lokální podobnosti Na rozdíl od klasického aligmentu velmi efektivní nástroj jak rychle vyhledávat ve velkých databázích (např. GenBank) Podobné nástroje: BLAT, FASTA

28 BLAST Základní BLAST – prohlédávání celé databáze pomocí nukleotidové sekvence Vyhledávání v jednotlivých referenčních genomech

29 BLAST Vložit sekvenci Zvolit “Others” Zvolit databázi, ve které chceme BLASTovat

30 Příklad 1 Vyhledejte sekvence nejpodobnější cytochromu b mamuta z tří jiných druhů Vytvořte multiple FASTA soubor Proveďte multiple alignment stažených sekvencích BLAST na NCBI – „nucleotide blast” option - “reference genomic sequences” databáze (nonredundantní genomické sekvence) Stáhnout protein-kódující sekvence cytochromu b Vytvořit v libovolném textovém editoru multiple FASTA soubor Provést multiple alignment (na EBI – na webu, BioEdit – na počítači) EBI (www.ebi.ac.uk) – services – DNA & RNA – Clustal2W BioEdit – Accessory Applications – ClustalW Multiple Alignment Postup:

31 Příklad 2 Úloha ze života BLAST ke zjištění zdroje kontaminace – např. sekvenuji mamuty – nezdá se mi jedna se sekvencí Postup: Jedna ze dvou sekvencí na stránkách praktika BLAST - “nucleotide blast” option ???

32 Navržení primerů pro PCR Maskování repeatů Design primerů In Silico PCR (e-PCR)

33 Maskování repeatů: RepeatMasker Umožní vyhledat a „zakrýt“ oblasti, které jsou v genomu ve větším počtu (mikrosatelity, retrotranspozony a transpozony) Umožní nám to při navrhování primerů se vyvarovat nespecifickým amplifikacím při PCR Pouze ale organismy, které jsou buď již osekvenovány anebo jsou jim blízce příbuzné (retrotransposony a transposony) X mikrosatelity lze maskovat u jakýchkoliv organismů

34 Zamaskovaná sekvence Pomocí N nebo použitím malých písmen (většina programů určených pro analýzu sekvencí s nimi umí pracovat) >MusY.1 ACACTTTTTCTTTTGCATAATGCTGTGTGGAGATTTTGCAGACAGCATTG CTGTAAAATGCAGAGTAATTTCTGTAATGAGCTTGTGAAATATTGACTAT TATGGCCCTCTCTAAGCATGGCTTTAATTATATTCTAGCACAGCAGCTTC TCTGGGGATACTCAGGTCAGATCACTGACTGAATGTTGTGTTCATTTGAA ACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNGTCATTTGTTGGTGTGCTGAATTCTGTTTTGTTTTGCTTTTAACCTAA CTAGCTAGAAATTCTGTCAATCTTTTTTCCTTCCTAGAAAGANNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNGAAACACAGGCTTT

35 RepeatMasker

36 Vložit nukleotidovou sekvenci Vybrat organismus

37 RepeatMasker Výstup analýzy RepeatMaskeru

38 RepeatMasker Výstup analýzy RepeatMaskeru

39 Design primerů: Primer3, Primer3Plus TCCGAAAATCCCACCAATTATCAACGACTCATTC F R

40 TGCG{CGCTAAGA AA[CACACACACA]CGGAATTAGGGAAC}TT Included RegionTargetExcluded Region

41 Maskování repeatů Koncentrace Mg2+ Koncentrace dNTPs Rozestup primerů => délka amplifikované oblasti

42 Elektronická PCR (e-PCR) Vezme dvojici primerů a zkouší, zda-li by PCR ve známém genomu amplifikovala pouze námi požadovanou oblast nebo i jiné oblasti Server UCSC (http://www.genome.ucsc.edu/) Lze i na NCBI

43 e-PCR

44 Organismus Assembly F a R primery

45 Příklad Sekvence mikrosatelitů z myšího Y chromosomu na stránkách praktik (vytvořte multiple FASTA) Zamaskujte mikrosatelity pomocí RepeatMaskeru Navrhněte kolem nich primery v Primer3 Zjistěte, které z těchto primerů jsou dále použitelné pomocí e-PCR

46 Celogenomová data Pozice genů v genomu – koordinátový systém Verze assembly Práce s genomovými prohlížeči –1 gen –>1 genů (Biomart)

47 Pozice genů v genomu Genomický koordinátový systém – založený na fyzické pozici nukleotidů v rámci většího celku (např. kontigu, chromozomu) Tvoří pak tzv. fyzickou mapu (v base pairs: bp) –např. u myši je začátek chromozomu na centromeře (pozice 1) –např. gen SRY chrY:1,918,381-1,919,568 (přibližná pozice pak 1.9 Mb) Jiné mapy: cytogenetická mapa, genetická mapa (cM)

48 Assembly Verze koordinátového systému Počáteční verze genomu postrádají hůře sekvenovatelné oblasti – jsou zaplněny Nky, ale postupně dochází k neustálému zpřesňování genomické sekvence = zpřesňování fyzické mapy Rozdíl ve fyzikální pozici genů mezi různými assembly (až několik Mb) Adh5 (Alcohol dehydrogenase 5) chr3: 138,443, ,455,499chr3:138,106, ,118,463 GRCm38 NCBIM37

49 Genomové prohlížeče Ensembl, UCSC, NCBI Nejvíce user-friendly asi Ensembl... VERZE

50 Příklad Najděte tyto informace o genu Adh5 v myším genomu: Počet transkriptů, typ transkriptu? Kolik exonů má kanonický transkript? Jaká proteinová rodina (ID)? Kolik druhů dostupných na Ensembl má alespoň jeden ortholog tohoto genu? Ve kterém taxonu dostupném na Ensembl je největší počet homologů tohoto genu? Získejte protein-kódující sekvence genu (vždy kanonický transkript) pro všechny hlodavce na Ensemblu, exportujte je do FASTA formátu, proveďte alignment

51 BioMart Při práci s více geny – efektivní získávání dat Pracuje na principu filtru – lze nastavit parametry výběru tzn. filtrovat na základě: –pozice v genomu –ID genů (konverze ID z různých databází) –genové rodiny –orthology –paralogy –... Výstup lze uložit jako.txt,.csv nebo.xls soubor

52 BioMart (Ensembl)

53 Dababáze Dataset = organismus Verze se aktualizuje každé cca 2-3 měsíce Důležité: pamatovat si verzi se kterou pracuji!!!

54 Parametry výběru: kritéria definující set genů Požadovaná data ve výstupu Propojení s daty z jiných organismů (pokročilé)

55 Kritéria výběru: pozice v genomu

56 Výběr atributů ve výstupu

57

58 Seznámení s BioMartem Na základě jakých všech kritérií je možné filtrovat? Jaká data lze na BioMartu získat – možnosti atributů?

59 Příklad 1 Oblast na chromosomu 11 (23 – 25 Mb) byla asociována s reprodukční izolací mezi dvěma druhy myši domácí. Cílem je získat seznam protein-kódujících genů v této oblasti a vybrat kandidáty pro další výzkum (předpoklad: rychle se vyvíjející se geny mají větší pravděpodobnost být zodpověné za vznik reprodukční bariéry). Postup: –Získejte seznam genů včetně jména a popisu spolu s pozicí v genomu, orthologů u potkana a informace o rychlosti molekulární evoluce mezi potkanem a myší z oblasti chr11: –Exportujte data do excelové tabulky seřaďte geny nejvíce kandidátních po nejméně kandidátní, určete kandidáty

60 Příklad 2 Získejte protein-kódující sekvence všech genů z rodiny tzv. hlavních močových proteinů (Major Urinary Proteins) v genomu myši a proveďte multiple alignment Postup: –Získejte ID rodiny MUPs –Použijte BioMart k získání protein-kódujících sekvencí MUPů a exportujte je do FASTA souboru


Stáhnout ppt "Stránky praktika (http://www.natur.cuni.cz/~muncling)"

Podobné prezentace


Reklamy Google